PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC012760.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 128aa    MW: 13805.3 Da    PI: 11.4044
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC012760.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA34.62.7e-113263435
          GATA  4 CgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                    + kTp+WR gp g +tL naCG+ yr+ ++
  EcC012760.10 32 YTSEKTPQWRTGPLGRRTLYNACGVQYRSGRQ 63
                  55678***********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.5E-52373IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.71E-72472No hitNo description
Gene3DG3DSA:3.30.50.103.4E-82761IPR013088Zinc finger, NHR/GATA-type
PfamPF003204.1E-92963IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
RLGTSPAALN EGPGPTEVEG DRGGAKRRCT HYTSEKTPQW RTGPLGRRTL YNACGVQYRS  60
GRQVPKYRLV VSPTFLLTQQ SNSHWKAALS DSRPRNRHSR TAPSRIHSPA SEGAGPAEAE  120
GGGGGVKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002876563.13e-26zinc finger family protein
SwissprotO497411e-26GATA2_ARATH; GATA transcription factor 2
TrEMBLA0A0A9GYF63e-27A0A0A9GYF6_ARUDO; Uncharacterized protein
STRINGfgenesh2_kg.5__2520__AT3G60530.11e-25(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.15e-28GATA transcription factor 2